PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy019202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 754aa    MW: 84929.6 Da    PI: 4.8961
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59522162PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.45.9e-1143767511373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+avs+ d++ a++lL++++++++p+gd++qR a+yf+++L+arl++ ++++    +  +t++ + +e l+a+k+f +++P+ kf+++ aN+
  Ahy019202 376 LRTLLVLCAQAVSACDNRTATELLKQIRQHSTPSGDATQRTAHYFANGLEARLHGDGTGTQGFYTYVSTKRLSAAEFLKAYKVFMNACPFSKFANFFANK 475
                5789***************************************************999999888888888888*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                +I++a++++e++HiiDf+i +G+QWp L++ L++R+ gp  +l+iTg++ p++g   +e+l+etg+rLa+++e+++vpfe+n+++++++e++++e+L+++
  Ahy019202 476 MIMKAAQNAETLHIIDFGILYGFQWPILIKFLSDRETGPLkKLKITGIEFPQPGfrPAERLNETGRRLANYCERFKVPFEYNAIASRNWETIQVEDLKIE 575
                ************************************66544************9*****************************9999************* PP

       GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                ++E laVn++ + ++l+de+ +++s+rd+vL+l+k+++P+++v +  + ++n++ F++rf eal ++sa++d+ +a +pr++e+r+k+Ere++gre+ nv
  Ahy019202 576 SNEFLAVNCHKRFENLMDETIEVNSPRDAVLQLIKKINPDIFVQAIVNGSYNAPFFATRFREALFHFSAIYDMCDAVIPRDNEKRMKIEREIIGREVLNV 675
                **************************************************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                vaceg+er+ r et+++W++r ++aGFk++pl+e+ +++ ++ l++ + + +  +e+ +++++gWk+r L++ ++W
  Ahy019202 676 VACEGFERIDRPETYKQWQARNTRAGFKQLPLNEELMAKFSAKLKEWYHKDFVFDEDGNWMLQGWKGRVLYASTCW 751
                ************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.024350732IPR005202Transcription factor GRAS
PfamPF035142.1E-111376751IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MDPNYPIGGS DDFMNSFQIG EDGHHGTIIF SDDQNQFYYD ANQHLDPLYQ HVADQLFDEF  60
PQYTSHVEEA AAAPVASTVV DPSVEDADFS ETAKFITQVL MEEGVEQRPF YDPFSLNATE  120
QSFYDALNDV LIDNINMPLS PNEHPLDVHH QGGTTSSSSS GSNSGNNNDN QNNNNPVDEN  180
SSEFLKPSVS PDTFSSGDHA FQFNSHAISQ HDSNASYVTN FGVYDVDTSF TKLLAQNIFS  240
DSDSVSQFRR GLEEASKFLP PGPQLVTGFE TTPAVAVPID ELKGDKAVGL KGRKNHEREE  300
WSDDTEEGRS NKHSATSSVV DESELSEMFD KVLLSIGAPM CFPVNNEVEK ASNPSTSNGG  360
KGRPKRQGKK KETIDLRTLL VLCAQAVSAC DNRTATELLK QIRQHSTPSG DATQRTAHYF  420
ANGLEARLHG DGTGTQGFYT YVSTKRLSAA EFLKAYKVFM NACPFSKFAN FFANKMIMKA  480
AQNAETLHII DFGILYGFQW PILIKFLSDR ETGPLKKLKI TGIEFPQPGF RPAERLNETG  540
RRLANYCERF KVPFEYNAIA SRNWETIQVE DLKIESNEFL AVNCHKRFEN LMDETIEVNS  600
PRDAVLQLIK KINPDIFVQA IVNGSYNAPF FATRFREALF HFSAIYDMCD AVIPRDNEKR  660
MKIEREIIGR EVLNVVACEG FERIDRPETY KQWQARNTRA GFKQLPLNEE LMAKFSAKLK  720
EWYHKDFVFD EDGNWMLQGW KGRVLYASTC WVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-463807518374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187271.10.0PREDICTED: scarecrow-like protein 31
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0S3SD400.0A0A0S3SD40_PHAAN; Uncharacterized protein
STRINGGLYMA11G14720.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14